Display Filter Reference: InfiniBand

Protocol field name: infiniband

Versions: 1.0.0 to 4.0.3

Back to Display Filter Reference

Field name Description Type Versions
infiniband.aeth ACK Extended Transport Header Byte sequence 1.0.0 to 4.0.3
infiniband.aeth.msn Message Sequence Number Unsigned integer (3 bytes) 1.0.0 to 4.0.3
infiniband.aeth.syndrome Syndrome Unsigned integer (1 byte) 1.0.0 to 4.0.3
infiniband.aeth.syndrome.credit_count Credit Count Unsigned integer (1 byte) 2.6.0 to 4.0.3
infiniband.aeth.syndrome.error_code Error Code Unsigned integer (1 byte) 2.6.0 to 4.0.3
infiniband.aeth.syndrome.opcode OpCode Unsigned integer (1 byte) 2.6.0 to 4.0.3
infiniband.aeth.syndrome.reserved Reserved Unsigned integer (1 byte) 2.6.0 to 4.0.3
infiniband.aeth.syndrome.reserved_value Reserved Unsigned integer (1 byte) 2.6.0 to 4.0.3
infiniband.aeth.syndrome.timer Timer Unsigned integer (1 byte) 2.6.0 to 4.0.3
infiniband.atomicacketh Atomic ACK Extended Transport Header Byte sequence 1.0.0 to 4.0.3
infiniband.atomicacketh.origremdt Original Remote Data Unsigned integer (8 bytes) 1.0.0 to 4.0.3
infiniband.atomiceth Atomic Extended Transport Header Byte sequence 1.0.0 to 4.0.3
infiniband.atomiceth.cmpdt Compare Data Unsigned integer (8 bytes) 1.0.0 to 4.0.3
infiniband.atomiceth.r_key Remote Key Unsigned integer (4 bytes) 1.0.0 to 1.0.16
infiniband.atomiceth.swapdt Swap (Or Add) Data Unsigned integer (8 bytes) 1.0.0 to 4.0.3
infiniband.atomiceth.va Virtual Address Unsigned integer (8 bytes) 1.0.0 to 1.0.16
infiniband.bth Base Transport Header Byte sequence 1.0.0 to 4.0.3
infiniband.bth.a Acknowledge Request Boolean 1.0.0 to 4.0.3
infiniband.bth.destqp Destination Queue Pair Unsigned integer (3 bytes) 1.0.0 to 4.0.3
infiniband.bth.m MigReq Boolean 1.0.0 to 4.0.3
infiniband.bth.opcode Opcode Unsigned integer (1 byte) 1.0.0 to 4.0.3
infiniband.bth.p_key Partition Key Unsigned integer (2 bytes) 1.0.0 to 4.0.3
infiniband.bth.padcnt Pad Count Unsigned integer (1 byte) 1.0.0 to 4.0.3
infiniband.bth.psn Packet Sequence Number Unsigned integer (3 bytes) 1.0.0 to 4.0.3
infiniband.bth.reserved7 Reserved (7 bits) Unsigned integer (1 byte) 1.0.0 to 4.0.3
infiniband.bth.reserved8 Reserved (8 bits) Unsigned integer (1 byte) 1.0.0 to 2.4.16
infiniband.bth.se Solicited Event Boolean 1.0.0 to 4.0.3
infiniband.bth.tver Header Version Unsigned integer (1 byte) 1.0.0 to 4.0.3
infiniband.classportinfo ClassPortInfo (Performance Management MAD) Label 2.6.0 to 4.0.3
infiniband.classportinfo.baseversion BaseVersion Unsigned integer (1 byte) 2.6.0 to 4.0.3
infiniband.classportinfo.capabilitymask CapabilityMask Unsigned integer (2 bytes) 2.6.0 to 4.0.3
infiniband.classportinfo.capabilitymask2 CapabilityMask2 Unsigned integer (4 bytes) 2.6.0 to 4.0.3
infiniband.classportinfo.classversion ClassVersion Unsigned integer (1 byte) 2.6.0 to 4.0.3
infiniband.classportinfo.redirectfl RedirectFL Unsigned integer (3 bytes) 2.6.0 to 4.0.3
infiniband.classportinfo.redirectgid RedirectGID IPv6 address 2.6.0 to 4.0.3
infiniband.classportinfo.redirectlid RedirectLID Unsigned integer (2 bytes) 2.6.0 to 4.0.3
infiniband.classportinfo.redirectpkey RedirectP_Key Unsigned integer (2 bytes) 2.6.0 to 4.0.3
infiniband.classportinfo.redirectqkey RedirectQ_Key Unsigned integer (4 bytes) 2.6.0 to 4.0.3
infiniband.classportinfo.redirectqp RedirectQP Unsigned integer (3 bytes) 2.6.0 to 4.0.3
infiniband.classportinfo.redirectsl RedirectSL Unsigned integer (1 byte) 2.6.0 to 4.0.3
infiniband.classportinfo.redirecttc RedirectTC Unsigned integer (1 byte) 2.6.0 to 4.0.3
infiniband.classportinfo.reserved Reserved Unsigned integer (1 byte) 2.6.0 to 4.0.3
infiniband.classportinfo.resptimevalue RespTimeValue Unsigned integer (1 byte) 2.6.0 to 4.0.3
infiniband.classportinfo.trapfl TrapFL Unsigned integer (3 bytes) 2.6.0 to 4.0.3
infiniband.classportinfo.trapgid TrapGID IPv6 address 2.6.0 to 4.0.3
infiniband.classportinfo.traplid TrapLID Unsigned integer (2 bytes) 2.6.0 to 4.0.3
infiniband.classportinfo.trappkey TrapP_Key Unsigned integer (2 bytes) 2.6.0 to 4.0.3
infiniband.classportinfo.trapqkey TrapQ_Key Unsigned integer (4 bytes) 2.6.0 to 4.0.3
infiniband.classportinfo.trapqp TrapQP Unsigned integer (3 bytes) 2.6.0 to 4.0.3
infiniband.classportinfo.trapsl TrapSL Unsigned integer (1 byte) 2.6.0 to 4.0.3
infiniband.classportinfo.traptc TrapTC Unsigned integer (1 byte) 2.6.0 to 4.0.3
infiniband.cm.dreq.localcommid Local Communication ID Unsigned integer (4 bytes) 2.4.0 to 4.0.3
infiniband.cm.dreq.private PrivateData Byte sequence 2.4.0 to 4.0.3
infiniband.cm.dreq.remotecommid Remote Communication ID Unsigned integer (4 bytes) 2.4.0 to 4.0.3
infiniband.cm.drsp.localcommid Local Communication ID Unsigned integer (4 bytes) 2.4.0 to 4.0.3
infiniband.cm.drsp.private PrivateData Byte sequence 2.4.0 to 4.0.3
infiniband.cm.drsp.remotecommid Remote Communication ID Unsigned integer (4 bytes) 2.4.0 to 4.0.3
infiniband.cm.rej.ari Additional Reject Information (ARI) Byte sequence 1.6.0 to 4.0.3
infiniband.cm.rej.localcommid Local Communication ID Unsigned integer (4 bytes) 1.6.0 to 4.0.3
infiniband.cm.rej.msgrej Message REJected Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.rej.private PrivateData Byte sequence 1.6.0 to 4.0.3
infiniband.cm.rej.reason Reason Unsigned integer (2 bytes) 1.6.0 to 4.0.3
infiniband.cm.rej.rejinfolen Reject Info Length Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.rej.remotecommid Remote Communication ID Unsigned integer (4 bytes) 1.6.0 to 4.0.3
infiniband.cm.rej.reserved0 Reserved Unsigned integer (1 byte) 2.4.0 to 4.0.3
infiniband.cm.rej.reserved1 Reserved Unsigned integer (1 byte) 2.4.0 to 4.0.3
infiniband.cm.rep Local Communication ID Unsigned integer (4 bytes) 1.6.0 to 4.0.3
infiniband.cm.rep.e2eflowctrl End-To-End Flow Control Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.rep.failoveracc Failover Accepted Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.rep.initdepth Initiator Depth Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.rep.localcaguid Local CA GUID Unsigned integer (8 bytes) 1.6.0 to 4.0.3
infiniband.cm.rep.localeecn Local EE Context Number Unsigned integer (3 bytes) 1.6.0 to 4.0.3
infiniband.cm.rep.localqkey Local Q_Key Unsigned integer (4 bytes) 1.6.0 to 4.0.3
infiniband.cm.rep.localqpn Local QPN Unsigned integer (3 bytes) 1.6.0 to 4.0.3
infiniband.cm.rep.private PrivateData Byte sequence 1.6.0 to 4.0.3
infiniband.cm.rep.remotecommid Remote Communication ID Unsigned integer (4 bytes) 1.6.0 to 4.0.3
infiniband.cm.rep.reserved Reserved Unsigned integer (1 byte) 2.4.0 to 4.0.3
infiniband.cm.rep.respres Responder Resources Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.rep.rnrretrcount RNR Retry Count Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.rep.srq SRQ Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.rep.startpsn Starting PSN Unsigned integer (3 bytes) 1.6.0 to 4.0.3
infiniband.cm.rep.tgtackdelay Target ACK Delay Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.req Local Communication ID Unsigned integer (4 bytes) 1.6.0 to 4.0.3
infiniband.cm.req.alt_flowlabel Alternate Flow Label Unsigned integer (4 bytes) 1.6.0 to 4.0.3
infiniband.cm.req.alt_hoplim Alternate Hop Limit Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.req.alt_localacktout Alternate Local ACK Timeout Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.req.alt_localgid Alternate Local Port GID Byte sequence 1.6.0 to 4.0.3
infiniband.cm.req.alt_locallid Alternate Local Port LID Unsigned integer (2 bytes) 1.6.0 to 4.0.3
infiniband.cm.req.alt_pktrate Alternate Packet Rate Unsigned integer (4 bytes) 1.6.0 to 4.0.3
infiniband.cm.req.alt_remotegid Alternate Remote Port GID Byte sequence 1.6.0 to 4.0.3
infiniband.cm.req.alt_remotelid Alternate Remote Port LID Unsigned integer (2 bytes) 1.6.0 to 4.0.3
infiniband.cm.req.alt_reserved0 Reserved Unsigned integer (4 bytes) 2.4.0 to 4.0.3
infiniband.cm.req.alt_reserved1 Reserved Unsigned integer (1 byte) 2.4.0 to 4.0.3
infiniband.cm.req.alt_sl Alternate SL Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.req.alt_subnetlocal Alternate Subnet Local Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.req.alt_tfcclass Alternate Traffic Class Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.req.e2eflowctrl End-to-End Flow Control Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.req.ext_transport Extended Transport Unsigned integer (1 byte) 2.4.0 to 4.0.3
infiniband.cm.req.initdepth Initiator Depth Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.req.ip_cm IP CM Request Msg Byte sequence 2.4.0 to 4.0.3
infiniband.cm.req.ip_cm.dip4 IP CM Destination IP IPv4 address 2.4.0 to 4.0.3
infiniband.cm.req.ip_cm.dip6 IP CM Destination IP IPv6 address 2.4.0 to 4.0.3
infiniband.cm.req.ip_cm.ipv IP CM IP Version Unsigned integer (1 byte) 2.4.0 to 4.0.3
infiniband.cm.req.ip_cm.majv IP CM Major Version Unsigned integer (1 byte) 2.4.0 to 4.0.3
infiniband.cm.req.ip_cm.minv IP CM Minor Version Unsigned integer (1 byte) 2.4.0 to 4.0.3
infiniband.cm.req.ip_cm.private IP CM Consumer PrivateData Byte sequence 2.4.0 to 4.0.3
infiniband.cm.req.ip_cm.reserved IP CM Reserved Unsigned integer (1 byte) 2.4.0 to 4.0.3
infiniband.cm.req.ip_cm.sip4 IP CM Source IP IPv4 address 2.4.0 to 4.0.3
infiniband.cm.req.ip_cm.sip6 IP CM Source IP IPv6 address 2.4.0 to 4.0.3
infiniband.cm.req.ip_cm.sport IP CM Source Port Unsigned integer (2 bytes) 2.4.0 to 4.0.3
infiniband.cm.req.localcaguid Local CA GUID Unsigned integer (8 bytes) 1.6.0 to 4.0.3
infiniband.cm.req.localeecn Local EECN Unsigned integer (3 bytes) 1.6.0 to 4.0.3
infiniband.cm.req.localqkey Local Q_Key Unsigned integer (4 bytes) 1.6.0 to 4.0.3
infiniband.cm.req.localqpn Local QPN Unsigned integer (3 bytes) 1.6.0 to 4.0.3
infiniband.cm.req.localresptout Local CM Response Timeout Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.req.maxcmretr Max CM Retries Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.req.pkey Partition Key Unsigned integer (2 bytes) 1.6.0 to 4.0.3
infiniband.cm.req.pppmtu Path Packet Payload MTU Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.req.prim_flowlabel Primary Flow Label Unsigned integer (4 bytes) 1.6.0 to 4.0.3
infiniband.cm.req.prim_hoplim Primary Hop Limit Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.req.prim_localacktout Primary Local ACK Timeout Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.req.prim_localgid Primary Local Port GID IPv6 address 1.6.0 to 4.0.3
infiniband.cm.req.prim_localgid_ipv4 Primary Local Port GID IPv4 address 2.4.0 to 4.0.3
infiniband.cm.req.prim_locallid Primary Local Port LID Unsigned integer (2 bytes) 1.6.0 to 4.0.3
infiniband.cm.req.prim_pktrate Primary Packet Rate Unsigned integer (4 bytes) 1.6.0 to 4.0.3
infiniband.cm.req.prim_remotegid Primary Remote Port GID IPv6 address 1.6.0 to 4.0.3
infiniband.cm.req.prim_remotegid_ipv4 Primary Remote Port GID IPv4 address 2.4.0 to 4.0.3
infiniband.cm.req.prim_remotelid Primary Remote Port LID Unsigned integer (2 bytes) 1.6.0 to 4.0.3
infiniband.cm.req.prim_reserved0 Reserved Unsigned integer (4 bytes) 2.4.0 to 4.0.3
infiniband.cm.req.prim_reserved1 Reserved Unsigned integer (1 byte) 2.4.0 to 4.0.3
infiniband.cm.req.prim_reserved2 Reserved Unsigned integer (1 byte) 2.4.0 to 4.0.3
infiniband.cm.req.prim_sl Primary SL Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.req.prim_subnetlocal Primary Subnet Local Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.req.prim_tfcclass Primary Traffic Class Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.req.private PrivateData Byte sequence 1.6.0 to 4.0.3
infiniband.cm.req.rdcexist RDC Exists Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.req.remoteeecn Remote EECN Unsigned integer (3 bytes) 1.6.0 to 4.0.3
infiniband.cm.req.remoteqpneecn Remote QPN/EECN Unsigned integer (3 bytes) 2.4.0 to 4.0.3
infiniband.cm.req.remoteresptout Remote CM Response Timeout Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.req.responderres Responder Resources Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.req.retrcount Retry Count Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.req.rnrretrcount RNR Retry Count Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.req.serviceid ServiceID Unsigned integer (8 bytes) 1.6.0 to 4.0.3
infiniband.cm.req.serviceid.dport Destination Port Unsigned integer (2 bytes) 2.4.0 to 4.0.3
infiniband.cm.req.serviceid.prefix Prefix Byte sequence 2.4.0 to 4.0.3
infiniband.cm.req.serviceid.protocol Protocol Unsigned integer (1 byte) 2.4.0 to 4.0.3
infiniband.cm.req.srq SRQ Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.req.startpsn Starting PSN Unsigned integer (3 bytes) 1.6.0 to 4.0.3
infiniband.cm.req.transpsvctype Transport Service Type Unsigned integer (1 byte) 1.6.0 to 4.0.3
infiniband.cm.rtu.localcommid Local Communication ID Unsigned integer (4 bytes) 1.6.0 to 4.0.3
infiniband.cm.rtu.private PrivateData Byte sequence 1.6.0 to 4.0.3
infiniband.cm.rtu.remotecommid Remote Communication ID Unsigned integer (4 bytes) 1.6.0 to 4.0.3
infiniband.deth Datagram Extended Transport Header Byte sequence 1.0.0 to 4.0.3
infiniband.deth.q_key Queue Key Unsigned integer (8 bytes) 1.0.0 to 4.0.3
infiniband.deth.reserved8 Reserved (8 bits) Unsigned integer (4 bytes) 1.0.0 to 2.4.16
infiniband.deth.srcqp Source Queue Pair Unsigned integer (4 bytes) 1.0.0 to 4.0.3
infiniband.eoib Mellanox EoIB Encapsulation Header Label 1.6.0 to 2.2.17
infiniband.eoib.fcs FCS Field Present Boolean 1.6.0 to 4.0.3
infiniband.eoib.ip_chk IP Checksum Unsigned integer (2 bytes) 1.6.0 to 4.0.3
infiniband.eoib.ip_seg_id Segment ID Unsigned integer (2 bytes) 1.6.0 to 4.0.3
infiniband.eoib.ip_seg_offset Segment Offset Unsigned integer (2 bytes) 1.6.0 to 4.0.3
infiniband.eoib.ms More Segments to Follow Boolean 1.6.0 to 4.0.3
infiniband.eoib.tcp_chk TCP Checksum Unsigned integer (2 bytes) 1.6.0 to 4.0.3
infiniband.eoib.version Version Unsigned integer (2 bytes) 1.6.0 to 4.0.3
infiniband.grh Global Route Header Byte sequence 1.0.0 to 4.0.3
infiniband.grh.dgid Destination GID IPv6 address 1.0.0 to 4.0.3
infiniband.grh.flowlabel Flow Label Unsigned integer (4 bytes) 1.0.0 to 4.0.3
infiniband.grh.hoplmt Hop Limit Unsigned integer (1 byte) 1.0.0 to 4.0.3
infiniband.grh.ipver IP Version Unsigned integer (1 byte) 1.0.0 to 4.0.3
infiniband.grh.nxthdr Next Header Unsigned integer (1 byte) 1.0.0 to 4.0.3
infiniband.grh.paylen Payload Length Unsigned integer (2 bytes) 1.0.0 to 4.0.3
infiniband.grh.sgid Source GID IPv6 address 1.0.0 to 4.0.3
infiniband.grh.tclass Traffic Class Unsigned integer (2 bytes) 1.0.0 to 4.0.3
infiniband.ieth RKey Byte sequence 1.0.0 to 4.0.3
infiniband.immdt Immediate Data Byte sequence 1.0.0 to 4.0.3
infiniband.informinfo.gid GID IPv6 address 1.0.6 to 4.0.3
infiniband.informinfo.isgeneric IsGeneric Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.informinfo.lidrangebegin LIDRangeBegin Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.informinfo.lidrangeend LIDRangeEnd Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.informinfo.producertypevendorid ProducerTypeVendorID Unsigned integer (3 bytes) 1.0.6 to 4.0.3
infiniband.informinfo.qpn QPN Unsigned integer (3 bytes) 1.0.6 to 4.0.3
infiniband.informinfo.resptimevalue RespTimeValue Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.informinfo.subscribe Subscribe Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.informinfo.trapnumberdeviceid TrapNumberDeviceID Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.informinfo.type Type Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.informinforecord.enum Enum Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.informinforecord.subscribergid SubscriberGID IPv6 address 1.0.6 to 4.0.3
infiniband.invariant.crc Invariant CRC Unsigned integer (4 bytes) 1.0.0 to 4.0.3
infiniband.ledinfo.ledmask LedMask Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.linearforwardingtable.linearforwardingtableblock LinearForwardingTableBlock Byte sequence 1.0.6 to 1.0.16
infiniband.linearforwardingtable.port Port Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.linkrecord.fromlid FromLID Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.linkrecord.fromport FromPort Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.linkrecord.servicedata ServiceData Byte sequence 1.0.6 to 4.0.3
infiniband.linkrecord.servicegid ServiceGID IPv6 address 1.0.6 to 4.0.3
infiniband.linkrecord.serviceid ServiceID Unsigned integer (8 bytes) 1.0.6 to 4.0.3
infiniband.linkrecord.servicekey ServiceKey Byte sequence 1.0.6 to 4.0.3
infiniband.linkrecord.servicelease ServiceLease Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.linkrecord.servicename ServiceName Byte sequence 1.0.6 to 4.0.3
infiniband.linkrecord.servicep_key ServiceP_Key Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.linkrecord.tolid ToLID Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.linkrecord.toport ToPort Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.linkspeedwidthpairstable.numtables NumTables Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.linkspeedwidthpairstable.portmask PortMask Byte sequence 1.0.6 to 4.0.3
infiniband.linkspeedwidthpairstable.speedfive Speed 5 Gbps Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.linkspeedwidthpairstable.speedten Speed 10 Gbps Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.linkspeedwidthpairstable.speedtwofive Speed 2.5 Gbps Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.lrh Local Route Header Byte sequence 1.0.0 to 4.0.3
infiniband.lrh.dlid Destination Local ID Unsigned integer (2 bytes) 1.0.0 to 4.0.3
infiniband.lrh.lnh Link Next Header Unsigned integer (1 byte) 1.0.0 to 4.0.3
infiniband.lrh.lver Link Version Unsigned integer (1 byte) 1.0.0 to 4.0.3
infiniband.lrh.pktlen Packet Length Unsigned integer (2 bytes) 1.0.0 to 4.0.3
infiniband.lrh.reserved2 Reserved (2 bits) Unsigned integer (1 byte) 1.0.0 to 4.0.3
infiniband.lrh.reserved5 Reserved (5 bits) Unsigned integer (2 bytes) 1.0.0 to 4.0.3
infiniband.lrh.sl Service Level Unsigned integer (1 byte) 1.0.0 to 4.0.3
infiniband.lrh.slid Source Local ID Unsigned integer (2 bytes) 1.0.0 to 4.0.3
infiniband.lrh.vl Virtual Lane Unsigned integer (1 byte) 1.0.0 to 4.0.3
infiniband.mad MAD (Management Datagram) Common Header Byte sequence 1.0.6 to 4.0.3
infiniband.mad.attributeid Attribute ID Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.mad.attributemodifier Attribute Modifier Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.mad.baseversion Base Version Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.mad.classspecific Class Specific Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.mad.classversion Class Version Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.mad.data MAD Data Payload Byte sequence 1.0.6 to 4.0.3
infiniband.mad.method Method Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.mad.mgmtclass Management Class Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.mad.reserved1 Reserved Unsigned integer (1 byte) 1.0.6 to 1.0.16
infiniband.mad.reserved16 Reserved Unsigned integer (2 bytes) 1.0.6 to 2.4.16
infiniband.mad.status Status Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.mad.transactionid Transaction ID Unsigned integer (8 bytes) 1.0.6 to 4.0.3
infiniband.mcmemberrecord.flowlabel FlowLabel Unsigned integer (3 bytes) 1.0.6 to 4.0.3
infiniband.mcmemberrecord.hoplimit HopLimit Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.mcmemberrecord.joinstate JoinState Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.mcmemberrecord.mgid MGID IPv6 address 1.0.6 to 4.0.3
infiniband.mcmemberrecord.mlid MLID Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.mcmemberrecord.mtu MTU Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.mcmemberrecord.mtuselector MTUSelector Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.mcmemberrecord.p_key P_Key Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.mcmemberrecord.packetlifetime PacketLifeTime Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.mcmemberrecord.packetlifetimeselector PacketLifeTimeSelector Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.mcmemberrecord.portgid PortGID IPv6 address 1.0.6 to 4.0.3
infiniband.mcmemberrecord.proxyjoin ProxyJoin Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.mcmemberrecord.q_key Q_Key Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.mcmemberrecord.rate Rate Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.mcmemberrecord.rateselector RateSelector Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.mcmemberrecord.scope Scope Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.mcmemberrecord.sl SL Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.mcmemberrecord.tclass TClass Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.multicastforwardingtable.multicastforwardingtableblock MulticastForwardingTableBlock Byte sequence 1.0.6 to 1.0.16
infiniband.multicastforwardingtable.portmask PortMask Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.multipathrecord.dgidcount DGIDCount Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.multipathrecord.flowlabel FlowLabel Unsigned integer (3 bytes) 1.0.6 to 4.0.3
infiniband.multipathrecord.gidscope GIDScope Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.multipathrecord.hoplimit HopLimit Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.multipathrecord.independenceselector IndependenceSelector Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.multipathrecord.mtu MTU Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.multipathrecord.mtuselector MTUSelector Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.multipathrecord.numbpath NumbPath Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.multipathrecord.p_key P_Key Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.multipathrecord.packetlifetime PacketLifeTime Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.multipathrecord.packetlifetimeselector PacketLifeTimeSelector Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.multipathrecord.rate Rate Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.multipathrecord.rateselector RateSelector Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.multipathrecord.rawtraffic RawTraffic Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.multipathrecord.reversible Reversible Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.multipathrecord.sdgid SDGID IPv6 address 1.0.6 to 4.0.3
infiniband.multipathrecord.sgidcount SGIDCount Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.multipathrecord.sl SL Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.multipathrecord.tclass TClass Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.nodedescription.nodestring NodeString Character string 1.0.6 to 4.0.3
infiniband.nodeinfo.baseversion BaseVersion Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.nodeinfo.classversion ClassVersion Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.nodeinfo.deviceid DeviceID Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.nodeinfo.localportnum LocalPortNum Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.nodeinfo.nodeguid NodeGUID Unsigned integer (8 bytes) 1.0.6 to 4.0.3
infiniband.nodeinfo.nodetype NodeType Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.nodeinfo.numports NumPorts Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.nodeinfo.partitioncap PartitionCap Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.nodeinfo.portguid PortGUID Unsigned integer (8 bytes) 1.0.6 to 4.0.3
infiniband.nodeinfo.revision Revision Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.nodeinfo.systemimageguid SystemImageGUID Unsigned integer (8 bytes) 1.0.6 to 4.0.3
infiniband.nodeinfo.vendorid VendorID Unsigned integer (3 bytes) 1.0.6 to 4.0.3
infiniband.notice.classtrapspecificdata ClassTrapSpecificData Byte sequence 1.0.6 to 1.0.16
infiniband.notice.datadetails DataDetails Byte sequence 1.0.6 to 4.0.3
infiniband.notice.isgeneric IsGeneric Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.notice.issuergid IssuerGID IPv6 address 1.0.6 to 1.0.16
infiniband.notice.issuerlid IssuerLID Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.notice.noticecount NoticeCount Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.notice.noticetoggle NoticeToggle Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.notice.producertypevendorid ProducerTypeVendorID Unsigned integer (3 bytes) 1.0.6 to 4.0.3
infiniband.notice.trapnumberdeviceid TrapNumberDeviceID Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.notice.type Type Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.p_keytable.membershiptype MembershipType Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.p_keytable.p_keybase P_KeyBase Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.p_keytable.p_keytableblock P_KeyTableBlock Byte sequence 1.0.6 to 4.0.3
infiniband.pathrecord.dgid DGID IPv6 address 1.0.6 to 4.0.3
infiniband.pathrecord.dlid DLID Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.pathrecord.flowlabel FlowLabel Unsigned integer (3 bytes) 1.0.6 to 4.0.3
infiniband.pathrecord.hoplimit HopLimit Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.pathrecord.mtu MTU Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.pathrecord.mtuselector MTUSelector Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.pathrecord.numbpath NumbPath Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.pathrecord.p_key P_Key Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.pathrecord.packetlifetime PacketLifeTime Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.pathrecord.packetlifetimeselector PacketLifeTimeSelector Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.pathrecord.preference Preference Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.pathrecord.rate Rate Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.pathrecord.rateselector RateSelector Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.pathrecord.rawtraffic RawTraffic Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.pathrecord.reversible Reversible Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.pathrecord.sgid SGID IPv6 address 1.0.6 to 4.0.3
infiniband.pathrecord.sl SL Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.pathrecord.slid SLID Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.pathrecord.tclass TClass Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.payload Payload Byte sequence 1.0.0 to 4.0.3
infiniband.portcounters Port Counters (Performance Management MAD) Label 1.4.0 to 4.0.3
infiniband.portcounters.counterselect CounterSelect Unsigned integer (2 bytes) 1.4.0 to 4.0.3
infiniband.portcounters.excessivebufferoverrunerrors ExcessiveBufferOverrunErrors Unsigned integer (1 byte) 1.4.0 to 4.0.3
infiniband.portcounters.linkdownedcounter LinkDownedCounter Unsigned integer (1 byte) 1.4.0 to 4.0.3
infiniband.portcounters.linkerrorrecoverycounter LinkErrorRecoveryCounter Unsigned integer (1 byte) 1.4.0 to 4.0.3
infiniband.portcounters.locallinkintegrityerrors LocalLinkIntegrityErrors Unsigned integer (1 byte) 1.4.0 to 4.0.3
infiniband.portcounters.portrcvconstrainterrors PortRcvConstraintErrors Unsigned integer (1 byte) 1.4.0 to 4.0.3
infiniband.portcounters.portrcvdata PortRcvData Unsigned integer (4 bytes) 1.4.0 to 4.0.3
infiniband.portcounters.portrcverrors PortRcvErrors Unsigned integer (2 bytes) 1.4.0 to 4.0.3
infiniband.portcounters.portrcvpkts PortRcvPkts Unsigned integer (4 bytes) 1.4.0 to 4.0.3
infiniband.portcounters.portrcvremotephysicalerrors PortRcvRemotePhysicalErrors Unsigned integer (2 bytes) 1.4.0 to 4.0.3
infiniband.portcounters.portrcvswitchrelayerrors PortRcvSwitchRelayErrors Unsigned integer (2 bytes) 1.4.0 to 4.0.3
infiniband.portcounters.portselect PortSelect Unsigned integer (1 byte) 1.4.0 to 4.0.3
infiniband.portcounters.portxmitconstrainterrors PortXmitConstraintErrors Unsigned integer (1 byte) 1.4.0 to 4.0.3
infiniband.portcounters.portxmitdata PortXmitData Unsigned integer (4 bytes) 1.4.0 to 4.0.3
infiniband.portcounters.portxmitdiscards PortXmitDiscards Unsigned integer (2 bytes) 1.4.0 to 4.0.3
infiniband.portcounters.portxmitpkts PortXmitPkts Unsigned integer (4 bytes) 1.4.0 to 4.0.3
infiniband.portcounters.symbolerrorcounter SymbolErrorCounter Unsigned integer (2 bytes) 1.4.0 to 4.0.3
infiniband.portcounters.vl15dropped VL15Dropped Unsigned integer (2 bytes) 1.4.0 to 4.0.3
infiniband.portcounters_ext Port Counters Extended (Performance Management MAD) Label 1.4.0 to 4.0.3
infiniband.portcounters_ext.counterselect CounterSelect Unsigned integer (2 bytes) 1.4.0 to 4.0.3
infiniband.portcounters_ext.portmulticastrcvpkts PortMulticastRcvPkts Unsigned integer (8 bytes) 1.4.0 to 4.0.3
infiniband.portcounters_ext.portmulticastxmitpkts PortMulticastXmitPkts Unsigned integer (8 bytes) 1.4.0 to 4.0.3
infiniband.portcounters_ext.portrcvdata PortRcvData Unsigned integer (8 bytes) 1.4.0 to 4.0.3
infiniband.portcounters_ext.portrcvpkts PortRcvPkts Unsigned integer (8 bytes) 1.4.0 to 4.0.3
infiniband.portcounters_ext.portselect PortSelect Unsigned integer (1 byte) 1.4.0 to 4.0.3
infiniband.portcounters_ext.portunicastrcvpkts PortUnicastRcvPkts Unsigned integer (8 bytes) 1.4.0 to 4.0.3
infiniband.portcounters_ext.portunicastxmitpkts PortUnicastXmitPkts Unsigned integer (8 bytes) 1.4.0 to 4.0.3
infiniband.portcounters_ext.portxmitdata PortXmitData Unsigned integer (8 bytes) 1.4.0 to 4.0.3
infiniband.portcounters_ext.portxmitpkts PortXmitPkts Unsigned integer (8 bytes) 1.4.0 to 4.0.3
infiniband.portinfo.capabilitymask CapabilityMask Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.capabilitymask.automaticmigrationsupported AutomaticMigrationSupported Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.capabilitymask.bootmanagementsupported BootManagementSupported Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.capabilitymask.capabilitymasknoticesupported CapabilityMaskNoticeSupported Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.capabilitymask.clientregistrationsupported ClientRegistrationSupported Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.capabilitymask.communicationmanagementsupported CommunicationManagementSupported Unsigned integer (4 bytes) 2.6.0 to 4.0.3
infiniband.portinfo.capabilitymask.communicationsmanagementsupported CommunicationsManagementSupported Unsigned integer (4 bytes) 1.0.6 to 2.4.16
infiniband.portinfo.capabilitymask.devicemanagementsupported DeviceManagementSupported Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.capabilitymask.drnoticesupported DRNoticeSupported Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.capabilitymask.issm SM Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.capabilitymask.ledinfosupported LEDInfoSupported Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.capabilitymask.linkroundtriplatencysupported LinkRoundTripLatencySupported Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.capabilitymask.linkspeedwidthpairstablesupported LinkSpeedWIdthPairsTableSupported Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.capabilitymask.mkeynvram MKeyNVRAM Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.capabilitymask.noticesupported NoticeSupported Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.capabilitymask.optionalipdsupported OptionalIPDSupported Unsigned integer (4 bytes) 2.6.0 to 4.0.3
infiniband.portinfo.capabilitymask.optionalpdsupported OptionalPDSupported Unsigned integer (4 bytes) 1.0.6 to 2.4.16
infiniband.portinfo.capabilitymask.otherlocalchangesnoticesupported OtherLocalChangesNoticeSupported Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.capabilitymask.pkeynvram PKeyNVRAM Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.capabilitymask.pkeyswitchexternalporttrapsupported PKeySwitchExternalPortTrapSupported Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.capabilitymask.reinitsupported ReinitSupported Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.capabilitymask.slmappingsupported SLMappingSupported Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.capabilitymask.smdisabled SMdisabled Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.capabilitymask.snmptunnelingsupported SNMPTunnelingSupported Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.capabilitymask.systemimageguidsupported SystemImageGUIDSupported Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.capabilitymask.trapsupported TrapSupported Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.capabilitymask.vendorclasssupported VendorClassSupported Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.clientreregister ClientReregister Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.diagcode DiagCode Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.filterrawinbound FilterRawInbound Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.filterrawoutbound FilterRawOutbound Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.guid GidPrefix Unsigned integer (8 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.guidcap GUIDCap Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.hoqlife HOQLife Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.inittype InitType Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.inittypereply InitTypeReply Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.lid LID Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.linkdowndefaultstate LinkDownDefaultState Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.linkroundtriplatency LinkRoundTripLatency Unsigned integer (3 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.linkspeedactive LinkSpeedActive Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.linkspeedenabled LinkSpeedEnabled Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.linkspeedsupported LinkSpeedSupported Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.linkwidthactive LinkWidthActive Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.linkwidthenabled LinkWidthEnabled Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.linkwidthsupported LinkWidthSupported Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.lmc LMC Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.localphyerrors LocalPhyErrors Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.localportnum LocalPortNum Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.m_key M_Key Unsigned integer (8 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.m_keyleaseperiod M_KeyLeasePeriod Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.m_keyprotectbits M_KeyProtectBits Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.m_keyviolations M_KeyViolations Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.mastersmlid MasterSMLID Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.mastersmsl MasterSMSL Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.maxcredithint MaxCreditHint Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.mtucap MTUCap Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.neighbormtu NeighborMTU Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.operationalvls OperationalVLs Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.overrunerrors OverrunErrors Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.p_keyviolations P_KeyViolations Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.partitionenforcementinbound PartitionEnforcementInbound Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.partitionenforcementoutbound PartitionEnforcementOutbound Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.portphysicalstate PortPhysicalState Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.portstate PortState Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.q_keyviolations Q_KeyViolations Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.portinfo.resptimevalue RespTimeValue Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.subnettimeout SubnetTimeOut Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.vlarbitrationhighcap VLArbitrationHighCap Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.vlarbitrationlowcap VLArbitrationLowCap Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.vlcap VLCap Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.vlhighlimit VLHighLimit Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.portinfo.vlstallcount VLStallCount Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.randomforwardingtable.lid LID Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.randomforwardingtable.lmc LMC Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.randomforwardingtable.port Port Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.randomforwardingtable.randomforwardingtableblock RandomForwardingTableBlock Byte sequence 1.0.6 to 1.0.16
infiniband.randomforwardingtable.valid Valid Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.rawdata Raw Data Byte sequence 1.0.0 to 4.0.3
infiniband.rdeth Reliable Datagram Extended Transport Header Byte sequence 1.0.0 to 4.0.3
infiniband.rdeth.eecnxt E2E Context Unsigned integer (3 bytes) 1.0.0 to 4.0.3
infiniband.rdeth.reserved8 Reserved (8 bits) Unsigned integer (1 byte) 1.0.0 to 2.4.16
infiniband.reserved Reserved Byte sequence 2.6.0 to 4.0.3
infiniband.reserved1 Reserved Unsigned integer (1 byte) 2.4.0 to 2.4.16
infiniband.reserved4 Reserved Unsigned integer (4 bytes) 2.4.0 to 2.4.16
infiniband.reth RDMA Extended Transport Header Byte sequence 1.0.0 to 4.0.3
infiniband.reth.dmalen DMA Length Unsigned integer (4 bytes) 1.0.0 to 4.0.3
infiniband.reth.r_key Remote Key Unsigned integer (4 bytes) 1.0.0 to 4.0.3
infiniband.reth.va Virtual Address Unsigned integer (8 bytes) 1.0.0 to 4.0.3
infiniband.rmpp RMPP (Reliable Multi-Packet Transaction Protocol) Byte sequence 1.0.6 to 4.0.3
infiniband.rmpp.data RMPP Data (Reliable Multi-Packet Transaction Protocol) Byte sequence 1.0.6 to 1.0.16
infiniband.rmpp.data1 RMPP Data 1 Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.rmpp.data2 RMPP Data 2 Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.rmpp.extendederrordata Optional Extended Error Data Byte sequence 1.0.6 to 4.0.3
infiniband.rmpp.newwindowlast New Window Last Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.rmpp.payloadlength Payload Length Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.rmpp.reserved220 Segment Number Byte sequence 1.0.6 to 2.4.16
infiniband.rmpp.reserved32 Reserved (32 bits) Byte sequence 1.8.0 to 2.4.16
infiniband.rmpp.rmppflags RMPP Flags Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.rmpp.rmppstatus RMPP Status Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.rmpp.rmpptype RMPP Type Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.rmpp.rmppversion RMPP Type Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.rmpp.rresptime R Resp Time Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.rmpp.segmentnumber Segment Number Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.rmpp.transferreddata Transferred Data Byte sequence 1.0.6 to 4.0.3
infiniband.rwh Raw Header Byte sequence 1.0.6 to 4.0.3
infiniband.rwh.etype Ethertype Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.rwh.reserved Reserved (16 bits) Unsigned integer (2 bytes) 1.0.6 to 2.4.16
infiniband.sa.attributeoffset Attribute Offset Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.sa.blocknum_eightbit BlockNum_EightBit Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.sa.blocknum_ninebit BlockNum_NineBit Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.sa.blocknum_sixteenbit BlockNum_SixteenBit Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.sa.componentmask Component Mask Unsigned integer (8 bytes) 1.0.6 to 4.0.3
infiniband.sa.drdlid SA Packet (Subnet Administration) Byte sequence 1.0.6 to 4.0.3
infiniband.sa.endportlid EndportLID Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.sa.index Index Unsigned integer (1 byte) 1.0.6 to 1.0.16
infiniband.sa.inputportnum InputPortNum Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.sa.lid LID Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.sa.outputportnum OutputPortNum Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.sa.portnum PortNum Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.sa.position Position Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.sa.smkey SM_Key (Verification Key) Unsigned integer (8 bytes) 1.0.6 to 4.0.3
infiniband.sa.subnetadmindata Subnet Admin Data Byte sequence 1.0.6 to 4.0.3
infiniband.serviceassociationrecord.servicekey ServiceKey Byte sequence 1.0.6 to 4.0.3
infiniband.serviceassociationrecord.servicename ServiceName Character string 1.0.6 to 4.0.3
infiniband.sltovlmappingtable.sltovlhighbits SL(x)toVL Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.sltovlmappingtable.sltovllowbits SL(x)toVL Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.sminfo.actcount ActCount Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.sminfo.guid GUID Unsigned integer (8 bytes) 1.0.6 to 4.0.3
infiniband.sminfo.priority Priority Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.sminfo.sm_key SM_Key Unsigned integer (8 bytes) 1.0.6 to 4.0.3
infiniband.sminfo.smstate SMState Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.smpdirected Subnet Management Packet (Directed Route) Byte sequence 1.0.6 to 4.0.3
infiniband.smpdirected.d D (Direction Bit) Unsigned integer (8 bytes) 1.0.6 to 4.0.3
infiniband.smpdirected.drdlid DrDLID Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.smpdirected.drslid DrSLID Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.smpdirected.hopcount Hop Count Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.smpdirected.hoppointer Hop Pointer Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.smpdirected.initialpath Initial Path Byte sequence 1.0.6 to 4.0.3
infiniband.smpdirected.reserved28 Reserved (224 bits) Byte sequence 1.0.6 to 2.4.16
infiniband.smpdirected.returnpath Return Path Byte sequence 1.0.6 to 4.0.3
infiniband.smpdirected.smpstatus Status Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.smplid Subnet Management Packet (LID Routed) Byte sequence 1.0.6 to 4.0.3
infiniband.smplid.mkey M_Key Unsigned integer (8 bytes) 1.0.6 to 4.0.3
infiniband.smplid.reserved1024 Reserved (1024 bits) Byte sequence 1.0.6 to 2.4.16
infiniband.smplid.reserved256 Reserved (256 bits) Byte sequence 1.0.6 to 2.4.16
infiniband.smplid.smpdata SMP Data Byte sequence 1.0.6 to 4.0.3
infiniband.switchinfo.defaultmulticastnotprimaryport DefaultMulticastNotPrimaryPort Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.switchinfo.defaultmulticastprimaryport DefaultMulticastPrimaryPort Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.switchinfo.defaultport DefaultPort Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.switchinfo.enhancedportzero EnhancedPortZero Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.switchinfo.filterrawinboundcap FilterRawInboundCap Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.switchinfo.filterrawoutboundcap FilterRawOutboundCap Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.switchinfo.guid GUID Unsigned integer (8 bytes) 1.0.6 to 4.0.3
infiniband.switchinfo.guidblock GUIDBlock Byte sequence 1.0.6 to 1.0.16
infiniband.switchinfo.inboundenforcementcap InboundEnforcementCap Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.switchinfo.lidsperport LIDsPerPort Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.switchinfo.lifetimevalue LifeTimeValue Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.switchinfo.linearfdbcap LinearFDBCap Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.switchinfo.linearfdbtop LinearFDBTop Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.switchinfo.multicastfdbcap MulticastFDBCap Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.switchinfo.optimizedsltovlmappingprogramming OptimizedSLtoVLMappingProgramming Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.switchinfo.outboundenforcementcap OutboundEnforcementCap Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.switchinfo.partitionenforcementcap PartitionEnforcementCap Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.switchinfo.portstatechange PortStateChange Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.switchinfo.randomfdbcap RandomFDBCap Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.tracerecord.chassisid ChassisID Unsigned integer (8 bytes) 1.8.0 to 4.0.3
infiniband.tracerecord.entryport EntryPort Unsigned integer (1 byte) 1.8.0 to 4.0.3
infiniband.tracerecord.entryportid EntryPortID Unsigned integer (8 bytes) 1.8.0 to 4.0.3
infiniband.tracerecord.exitport ExitPort Unsigned integer (1 byte) 1.8.0 to 4.0.3
infiniband.tracerecord.exitportid ExitPortID Unsigned integer (8 bytes) 1.8.0 to 4.0.3
infiniband.tracerecord.gidprefix GidPrefix Unsigned integer (8 bytes) 1.8.0 to 4.0.3
infiniband.tracerecord.idgeneration IDGeneration Unsigned integer (2 bytes) 1.8.0 to 4.0.3
infiniband.tracerecord.nodeid NodeID Unsigned integer (8 bytes) 1.8.0 to 4.0.3
infiniband.tracerecord.nodetype NodeType Unsigned integer (1 byte) 1.8.0 to 4.0.3
infiniband.trap.attributeid ATTRIBUTEID Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.trap.attributemodifier ATTRIBUTEMODIFIER Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.trap.capabilitymask CAPABILITYMASK Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.trap.comp_mask COMP_MASK Unsigned integer (8 bytes) 1.0.6 to 4.0.3
infiniband.trap.datavalid DataValid IPv6 address 1.0.6 to 4.0.3
infiniband.trap.drhopcount DRHopCount Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.trap.drnotice DRNotice Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.trap.drnoticereturnpath DRNoticeReturnPath Byte sequence 1.0.6 to 4.0.3
infiniband.trap.drpathtruncated DRPathTruncated Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.trap.drslid DRSLID Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.trap.gidaddr GIDADDR IPv6 address 1.0.6 to 4.0.3
infiniband.trap.gidaddr1 GIDADDR1 IPv6 address 1.0.6 to 4.0.3
infiniband.trap.gidaddr2 GIDADDR2 IPv6 address 1.0.6 to 4.0.3
infiniband.trap.key KEY Unsigned integer (4 bytes) 1.0.6 to 4.0.3
infiniband.trap.lidaddr LIDADDR Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.trap.lidaddr1 LIDADDR1 Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.trap.lidaddr2 LIDADDR2 Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.trap.linkspeecenabledchange LinkSpeecEnabledChange Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.trap.linkwidthenabledchange LinkWidthEnabledChange Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.trap.method METHOD Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.trap.mkey MKEY Unsigned integer (8 bytes) 1.0.6 to 4.0.3
infiniband.trap.nodedescriptionchange NodeDescriptionChange Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.trap.otherlocalchanges OtherLocalChanges Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.trap.path_rec PATH_REC Byte sequence 1.0.6 to 1.0.16
infiniband.trap.pkey PKEY Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.trap.portno PORTNO Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.trap.qp1 QP1 Unsigned integer (3 bytes) 1.0.6 to 4.0.3
infiniband.trap.qp2 QP2 Unsigned integer (3 bytes) 1.0.6 to 4.0.3
infiniband.trap.sl SL Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.trap.swlidaddr SWLIDADDR IPv6 address 1.0.6 to 4.0.3
infiniband.trap.systemimageguid SYSTEMIMAGEGUID Unsigned integer (8 bytes) 1.0.6 to 4.0.3
infiniband.trap.wait_for_repath WAIT_FOR_REPATH Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.variant.crc Variant CRC Unsigned integer (2 bytes) 1.0.0 to 4.0.3
infiniband.vendor Unknown/Vendor Specific Data Byte sequence 1.0.0 to 4.0.3
infiniband.vendordiag.diagdata DiagData Byte sequence 1.0.6 to 4.0.3
infiniband.vendordiag.nextindex NextIndex Unsigned integer (2 bytes) 1.0.6 to 4.0.3
infiniband.vlarbitrationtable.vl VL Unsigned integer (1 byte) 1.0.6 to 4.0.3
infiniband.vlarbitrationtable.vlweightpairs VLWeightPairs Byte sequence 1.0.6 to 1.0.16
infiniband.vlarbitrationtable.weight Weight Unsigned integer (1 byte) 1.0.6 to 4.0.3